Solution nmr structure of cyclin-dependent kinase 2-associated protein 1 (cdk2-associated protein 1; oral cancer suppressor deleted in oral cancer 1, doc-1) from h.sapiens, northeast structural genomics consortium target target hr3057h
PDB DOI: 10.2210/pdb2kw6/pdb
Classification: CELL CYCLE Organism(s): Homo Sapiens
Deposited: 2010-03-31 Deposition Author(s): Acton, T.B. , Aramini, J.M. , Ciccosanti, C.T. , Ertekin, A. , Everett, J.K. , Jiang, M. , Lee, A.B. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J.H. , Rossi, P. , Rost, B. , Swapna, G.V.T. , Xiao, R.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of cyclin-dependent kinase 2-associated protein 1 (cdk2-associated protein 1; oral cancer suppressor deleted in oral cancer 1, doc-1) from h.sapiens, northeast structural genomics consortium target target hr3057h
Acton, T.B. , Aramini, J.M. , Ciccosanti, C.T. , Ertekin, A. , Everett, J.K. , Jiang, M. , Lee, A.B. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J.H. , Rossi, P. , Rost, B. , Swapna, G.V.T. , Xiao, R.
Primary Citation of Related Structures: 2KW6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cyclin-dependent kinase 2-associated protein 1 | A | 65 | Homo Sapiens | MGHHHHHHSHSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS |
| Cyclin-dependent kinase 2-associated protein 1 | B | 65 | Homo Sapiens | MGHHHHHHSHSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS |
Method: SOLUTION NMR
Deposited Date: 2010-03-31 Deposition Author(s): Acton, T.B. , Aramini, J.M. , Ciccosanti, C.T. , Ertekin, A. , Everett, J.K. , Jiang, M. , Lee, A.B. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J.H. , Rossi, P. , Rost, B. , Swapna, G.V.T. , Xiao, R.