Solution nmr structure of the slr1183 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145
PDB DOI: 10.2210/pdb2kw5/pdb
Classification: Structural Genomics, Unknown function Organism(s): Synechocystis
Deposited: 2010-03-31 Deposition Author(s): Acton, T. , Baker, D. , Belote, R. , Ciccosanti, C. , Everett, J. , Foote, E. , Forouhar, F. , Lange, O. , Lee, H. , Lemak, A. , Maglaqui, M. , Mao, B. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rossi, P. , Sahdev, S. , Xiao, R.
Solution nmr structure of the slr1183 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145
Acton, T. , Baker, D. , Belote, R. , Ciccosanti, C. , Everett, J. , Foote, E. , Forouhar, F. , Lange, O. , Lee, H. , Lemak, A. , Maglaqui, M. , Mao, B. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rossi, P. , Sahdev, S. , Xiao, R.
Primary Citation of Related Structures: 2KW5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Slr1183 protein | A | 202 | Synechocystis | MWDERFSQSEYVYGTEPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNLDEGAYHQGKAALIQLLGQKLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2010-03-31 Deposition Author(s): Acton, T. , Baker, D. , Belote, R. , Ciccosanti, C. , Everett, J. , Foote, E. , Forouhar, F. , Lange, O. , Lee, H. , Lemak, A. , Maglaqui, M. , Mao, B. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rossi, P. , Sahdev, S. , Xiao, R.