2KUY
Structure of glycocin f
PDB DOI: 10.2210/pdb2kuy/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Lactobacillus Plantarum
Deposited: 2010-03-01 Deposition Author(s): Claridge, J. , Edwards, P. , Libich, D. , Loo, T. , Norris, G. , Pascal, S. , Patchett, M. , Schwalbe, M. , Stepper, J. , Venugopal, H.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of glycocin f
Claridge, J. , Edwards, P. , Libich, D. , Loo, T. , Norris, G. , Pascal, S. , Patchett, M. , Schwalbe, M. , Stepper, J. , Venugopal, H.
Primary Citation of Related Structures: 2KUY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Prebacteriocin glycocin F | A | 43 | Lactobacillus Plantarum | KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSSSYHC |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-03-01 Deposition Author(s): Claridge, J. , Edwards, P. , Libich, D. , Loo, T. , Norris, G. , Pascal, S. , Patchett, M. , Schwalbe, M. , Stepper, J. , Venugopal, H.