Solution structure of gmr58a from geobacter metallireducens. northeast structural genomics consortium target gmr58a
PDB DOI: 10.2210/pdb2kut/pdb
Classification: Structural Genomics, Unknown function Organism(s): Geobacter Metallireducens
Deposited: 2010-02-28 Deposition Author(s): Acton, T.B. , Buchwald, W.A. , Everett, J.K. , Janjua, H. , Lee, H. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J.H. , Rost, B. , Wang, H. , Xiao, R.
Solution structure of gmr58a from geobacter metallireducens. northeast structural genomics consortium target gmr58a
Acton, T.B. , Buchwald, W.A. , Everett, J.K. , Janjua, H. , Lee, H. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J.H. , Rost, B. , Wang, H. , Xiao, R.
Primary Citation of Related Structures: 2KUT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein | A | 122 | Geobacter Metallireducens | MDLPITLSKETPFEGEEITVSARVTNRGAAEAHNVPVAVYLGNPAQGGVEIGRDTISRIPVGGTGLARVQWKATRKLAGRAANPGVPVYAVVDPDNRVAESDKANNVFSRIVKVLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2010-02-28 Deposition Author(s): Acton, T.B. , Buchwald, W.A. , Everett, J.K. , Janjua, H. , Lee, H. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J.H. , Rost, B. , Wang, H. , Xiao, R.