Solution structure of vhl-2
PDB DOI: 10.2210/pdb2kuk/pdb
Classification: ANTIVIRAL PROTEIN Organism(s): Viola Hederacea
Deposited: 2010-02-18 Deposition Author(s): Chen, B. , Craik, D.J. , Daly, N.L. , Nguyencong, P.
Solution structure of vhl-2
Chen, B. , Craik, D.J. , Daly, N.L. , Nguyencong, P.
Primary Citation of Related Structures: 2KUK
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Leaf cyclotide 2 | A | 30 | Viola Hederacea | CGETCFTGTCYTNGCTCDPWPVCTRNGLPV |
Method: SOLUTION NMR
Deposited Date: 2010-02-18 Deposition Author(s): Chen, B. , Craik, D.J. , Daly, N.L. , Nguyencong, P.