Structural homology between the c-terminal domain of the papc usher and its plug
PDB DOI: 10.2210/pdb2kt6/pdb
Classification: TRANSPORT PROTEIN Organism(s): Escherichia Coli
Deposited: 2010-01-19 Deposition Author(s): Dodson, K. , Driscoll, P.C. , Ford, B. , Hultgren, S. , Pinkner, J. , Ragan, T.J. , Rego, A. , Waksman, G.
Structural homology between the c-terminal domain of the papc usher and its plug
Dodson, K. , Driscoll, P.C. , Ford, B. , Hultgren, S. , Pinkner, J. , Ragan, T.J. , Rego, A. , Waksman, G.
Primary Citation of Related Structures: 2KT6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Outer membrane usher protein papC | A | 85 | Escherichia Coli | VLKGKRLFAILRLADGSQPPFGASVTSEKGRELGMVADEGLAWLSGVTPGETLSVNWDGKIQCQVNVPETAISDQQLLLPCTPQK |
Method: SOLUTION NMR
Deposited Date: 2010-01-19 Deposition Author(s): Dodson, K. , Driscoll, P.C. , Ford, B. , Hultgren, S. , Pinkner, J. , Ragan, T.J. , Rego, A. , Waksman, G.