Solution nmr structure of the pcp_red domain of light-independent protochlorophyllide reductase subunit b from chlorobium tepidum. northeast structural genomics consortium target ctr69a
PDB DOI: 10.2210/pdb2kru/pdb
Classification: OXIDOREDUCTASE Organism(s): Chlorobaculum Tepidum
Deposited: 2009-12-22 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Eletsky, A. , Everett, J.K. , He, Y. , Janjua, H. , Lee, D. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Szyperski, T. , Xiao, R.
Solution nmr structure of the pcp_red domain of light-independent protochlorophyllide reductase subunit b from chlorobium tepidum. northeast structural genomics consortium target ctr69a
Acton, T.B. , Ciccosanti, C. , Eletsky, A. , Everett, J.K. , He, Y. , Janjua, H. , Lee, D. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Szyperski, T. , Xiao, R.
Primary Citation of Related Structures: 2KRU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Light-independent protochlorophyllide reductase subunit B | A | 63 | Chlorobaculum Tepidum | MGELSWTAEAEKMLGKVPFFVRKKVRKNTDNYAREIGEPVVTADVFRKAKEHLGGLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2009-12-22 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Eletsky, A. , Everett, J.K. , He, Y. , Janjua, H. , Lee, D. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Szyperski, T. , Xiao, R.