Nmr solution structure of the dna binding domain of competence protein a
PDB DOI: 10.2210/pdb2krf/pdb
Classification: TRANSCRIPTION Organism(s): Bacillus Subtilis
Deposited: 2009-12-16 Deposition Author(s): Bobay, B.G. , Cavanagh, J. , Hobbs, C.A. , Perego, M. , Thompson, R.J.
Nmr solution structure of the dna binding domain of competence protein a
Bobay, B.G. , Cavanagh, J. , Hobbs, C.A. , Perego, M. , Thompson, R.J.
Primary Citation of Related Structures: 2KRF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional regulatory protein comA | A | 73 | Bacillus Subtilis | GSHMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL |
| Transcriptional regulatory protein comA | B | 73 | Bacillus Subtilis | GSHMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL |
Method: SOLUTION NMR
Deposited Date: 2009-12-16 Deposition Author(s): Bobay, B.G. , Cavanagh, J. , Hobbs, C.A. , Perego, M. , Thompson, R.J.