2KRD
Solution structure of the regulatory domain of human cardiac troponin c in complex with the switch region of cardiac troponin i and w7
PDB DOI: 10.2210/pdb2krd/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-12-16 Deposition Author(s): Li, M.X. , Oleszczuk, M. , Robertson, I.M. , Sykes, B.D.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the regulatory domain of human cardiac troponin c in complex with the switch region of cardiac troponin i and w7
Li, M.X. , Oleszczuk, M. , Robertson, I.M. , Sykes, B.D.
Primary Citation of Related Structures: 2KRD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Troponin C, slow skeletal and cardiac muscles | C | 89 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS |
| Troponin I, cardiac muscle | I | 17 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RISADAMMQALLGARAK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-12-16 Deposition Author(s): Li, M.X. , Oleszczuk, M. , Robertson, I.M. , Sykes, B.D.