Solution nmr structure of the apo form of a ribonuclease h domain of protein dsy1790 from desulfitobacterium hafniense, northeast structural genomics target dhr1a
PDB DOI: 10.2210/pdb2kq2/pdb
Classification: HYDROLASE Organism(s): Desulfitobacterium Hafniense Dcb-2
Deposited: 2009-10-24 Deposition Author(s): Acton, T.B. , Belote, R.L. , Buchwald, W.A. , Ciccosanti, C. , Eletsky, A. , Everett, J.K. , Hua, J. , Janjua, H. , Mills, J.L. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Szyperski, T. , Xiao, R.
Solution nmr structure of the apo form of a ribonuclease h domain of protein dsy1790 from desulfitobacterium hafniense, northeast structural genomics target dhr1a
Acton, T.B. , Belote, R.L. , Buchwald, W.A. , Ciccosanti, C. , Eletsky, A. , Everett, J.K. , Hua, J. , Janjua, H. , Mills, J.L. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Szyperski, T. , Xiao, R.
Primary Citation of Related Structures: 2KQ2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribonuclease H-related protein | A | 147 | Desulfitobacterium Hafniense Dcb-2 | MDDRTEYDVYTDGSYVNGQYAWAYAFVKDGKVHYEDADVGKNPAAATMRNVAGEIAAALYAVKKASQLGVKIRILHDYAGIAFWATGEWKAKNEFTQAYAKLMNQYRGIYSFEKVKAHSGNEFNDYVDMKAKSALGIRDLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2009-10-24 Deposition Author(s): Acton, T.B. , Belote, R.L. , Buchwald, W.A. , Ciccosanti, C. , Eletsky, A. , Everett, J.K. , Hua, J. , Janjua, H. , Mills, J.L. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Szyperski, T. , Xiao, R.