Solution nmr structure of lin0431 protein from listeria innocua. northeast structural genomics consortium target lkr112
PDB DOI: 10.2210/pdb2kpp/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Listeria Innocua
Deposited: 2009-10-18 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Janjua, H. , Lee, D.Y. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Swapna, G.V.T. , Tang, Y. , Xiao, R.
Solution nmr structure of lin0431 protein from listeria innocua. northeast structural genomics consortium target lkr112
Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Janjua, H. , Lee, D.Y. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Swapna, G.V.T. , Tang, Y. , Xiao, R.
Primary Citation of Related Structures: 2KPP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Lin0431 protein | A | 114 | Listeria Innocua | MKNTGDEVVAIISQNGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWKSKAGDTIVCLPHKVFVEIKSTQKDSKDPDTDLIVPNLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2009-10-18 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Janjua, H. , Lee, D.Y. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Swapna, G.V.T. , Tang, Y. , Xiao, R.