Nmr solution structures of 3-oxooctanyl-acp from streptomyces coelicolor fatty acid synthase
PDB DOI: 10.2210/pdb2kop/pdb
Classification: TRANSPORT PROTEIN Organism(s): Streptomyces Coelicolor
Deposited: 2009-09-29 Deposition Author(s): Arthur, C.J. , Crump, M.P. , Ploskon, E.
Nmr solution structures of 3-oxooctanyl-acp from streptomyces coelicolor fatty acid synthase
Arthur, C.J. , Crump, M.P. , Ploskon, E.
Primary Citation of Related Structures: 2KOP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Acyl carrier protein | A | 81 | Streptomyces Coelicolor | AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA |
Method: SOLUTION NMR
Deposited Date: 2009-09-29 Deposition Author(s): Arthur, C.J. , Crump, M.P. , Ploskon, E.