Solution structure of complement repeat cr17 from lrp-1
PDB DOI: 10.2210/pdb2knx/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica
Deposited: 2009-09-07 Deposition Author(s): Guttman, M. , Komives, E.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of complement repeat cr17 from lrp-1
Primary Citation of Related Structures: 2KNX
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Prolow-density lipoprotein receptor-related protein 1 | A | 50 | Salmonella Enterica | GSEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNST |
Method: SOLUTION NMR
Deposited Date: 2009-09-07 Deposition Author(s): Guttman, M. , Komives, E.