Helical hairpin structure of pardaxin in lipopolysaccharide micelles: studied by nmr spectroscopy
PDB DOI: 10.2210/pdb2kns/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): N.A.
Deposited: 2009-09-03 Deposition Author(s): Bhattacharjya, S. , Bhunia, A. , Ramamoorthy, A.
Helical hairpin structure of pardaxin in lipopolysaccharide micelles: studied by nmr spectroscopy
Bhattacharjya, S. , Bhunia, A. , Ramamoorthy, A.
Primary Citation of Related Structures: 2KNS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pardaxin P-4 | A | 33 | N.A. | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE |
Method: SOLUTION NMR
Deposited Date: 2009-09-03 Deposition Author(s): Bhattacharjya, S. , Bhunia, A. , Ramamoorthy, A.