Solution structure of the cyclotide cycloviolacin o2
PDB DOI: 10.2210/pdb2knm/pdb
Classification: PLANT PROTEIN Organism(s): Viola Odorata
Deposited: 2009-08-27 Deposition Author(s): Rosengren, K.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the cyclotide cycloviolacin o2
Primary Citation of Related Structures: 2KNM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cycloviolacin-O2 | A | 30 | Viola Odorata | GIPCGESCVWIPCISSAIGCSCKSKVCYRN |
Method: SOLUTION NMR
Deposited Date: 2009-08-27 Deposition Author(s): Rosengren, K.