Nmr structure of hfn14
PDB DOI: 10.2210/pdb2kmz/pdb
Classification: APOPTOSIS Organism(s): Salmonella Enterica
Deposited: 2009-08-10 Deposition Author(s): Cuervo, H. , Day, E.S. , Krushinskie, D. , Pellegrini, M. , Perroud, M. , Schneider, P. , Strauch, K. , Sun, Y. , Willen, L. , Zheng, T.S.
Nmr structure of hfn14
Cuervo, H. , Day, E.S. , Krushinskie, D. , Pellegrini, M. , Perroud, M. , Schneider, P. , Strauch, K. , Sun, Y. , Willen, L. , Zheng, T.S.
Primary Citation of Related Structures: 2KMZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tumor necrosis factor receptor superfamily member 12A | A | 53 | Salmonella Enterica | EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP |
Method: SOLUTION NMR
Deposited Date: 2009-08-10 Deposition Author(s): Cuervo, H. , Day, E.S. , Krushinskie, D. , Pellegrini, M. , Perroud, M. , Schneider, P. , Strauch, K. , Sun, Y. , Willen, L. , Zheng, T.S.