2KMM
Solution nmr structure of the tgs domain of pg1808 from porphyromonas gingivalis. northeast structural genomics consortium target pgr122a (418-481)
PDB DOI: 10.2210/pdb2kmm/pdb
Classification: HYDROLASE Organism(s): Porphyromonas Gingivalis
Deposited: 2009-07-31 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Cort, J.R. , Everett, J.K. , Hamilton, K. , Kennedy, M.A. , Lee, D. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Rost, B. , Swapna, G. , Xiao, R. , Yang, Y.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of the tgs domain of pg1808 from porphyromonas gingivalis. northeast structural genomics consortium target pgr122a (418-481)
Acton, T.B. , Ciccosanti, C. , Cort, J.R. , Everett, J.K. , Hamilton, K. , Kennedy, M.A. , Lee, D. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Rost, B. , Swapna, G. , Xiao, R. , Yang, Y.
Primary Citation of Related Structures: 2KMM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Guanosine-3',5'-bis(Diphosphate) 3'-pyrophosphohydrolase | A | 73 | Porphyromonas Gingivalis | MEVMVFTPKGEIKRLPQGATALDFAYSLHSDLGDHCIGAKVNHKLVPLSYVLNSGDQVEVLSSKSLEHHHHHH |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-07-31 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Cort, J.R. , Everett, J.K. , Hamilton, K. , Kennedy, M.A. , Lee, D. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Rost, B. , Swapna, G. , Xiao, R. , Yang, Y.