Membrane-bound structure of the pf1 major coat protein in dhpc micelle
PDB DOI: 10.2210/pdb2klv/pdb
Classification: MEMBRANE PROTEIN Organism(s): Shewanella Frigidimarina
Deposited: 2009-07-08 Deposition Author(s): Mukhopadhyay, R. , Opella, S.J. , Park, S. , Son, W. , Valafar, H.
Membrane-bound structure of the pf1 major coat protein in dhpc micelle
Mukhopadhyay, R. , Opella, S.J. , Park, S. , Son, W. , Valafar, H.
Primary Citation of Related Structures: 2KLV
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Capsid protein G8P | A | 46 | Shewanella Frigidimarina | GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA |
Method: SOLUTION NMR
Deposited Date: 2009-07-08 Deposition Author(s): Mukhopadhyay, R. , Opella, S.J. , Park, S. , Son, W. , Valafar, H.