2KKE
Solution nmr structure of a dimeric protein of unknown function from methanobacterium thermoautotrophicum, northeast structural genomics consortium target tr5
PDB DOI: 10.2210/pdb2kke/pdb
Classification: Structural Genomics, Unknown function Organism(s): Methanothermobacter Thermautotrophicus Str. Delta H
Deposited: 2009-06-18 Deposition Author(s): Acton, T.B. , Everett, J.K. , Gunsalus, X. , Huang, L. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Swapna, G.V.T. , Xiao, K.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of a dimeric protein of unknown function from methanobacterium thermoautotrophicum, northeast structural genomics consortium target tr5
Acton, T.B. , Everett, J.K. , Gunsalus, X. , Huang, L. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Swapna, G.V.T. , Xiao, K.
Primary Citation of Related Structures: 2KKE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein | A | 53 | Methanothermobacter Thermautotrophicus Str. Delta H | MVGRRPGGGLKDTKPVVVRLYPDEIEALKSRVPANTSMSAYIRRIILNHLEDE |
| Uncharacterized protein | B | 53 | Methanothermobacter Thermautotrophicus Str. Delta H | MVGRRPGGGLKDTKPVVVRLYPDEIEALKSRVPANTSMSAYIRRIILNHLEDE |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-06-18 Deposition Author(s): Acton, T.B. , Everett, J.K. , Gunsalus, X. , Huang, L. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Swapna, G.V.T. , Xiao, K.