Solution structure of the extracellular domain of jtb
PDB DOI: 10.2210/pdb2kjx/pdb
Classification: MEMBRANE PROTEIN Organism(s): Salmonella Enterica
Deposited: 2009-06-10 Deposition Author(s): Bazan, F. , Fairbrother, W.J. , Lingel, A. , Pan, B. , Rousseau, F.
Solution structure of the extracellular domain of jtb
Bazan, F. , Fairbrother, W.J. , Lingel, A. , Pan, B. , Rousseau, F.
Primary Citation of Related Structures: 2KJX
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Jumping translocation breakpoint protein | A | 65 | Salmonella Enterica | GSGMKEFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQR |
Method: SOLUTION NMR
Deposited Date: 2009-06-10 Deposition Author(s): Bazan, F. , Fairbrother, W.J. , Lingel, A. , Pan, B. , Rousseau, F.