Dynamics of insulin probed by 1h-nmr amide proton exchange anomalous flexibility of the receptor-binding surface
PDB DOI: 10.2210/pdb2kjj/pdb
Classification: HORMONE Organism(s): Salmonella Enterica
Deposited: 2009-05-29 Deposition Author(s): Hua, Q.X. , Weiss, M.A.
Dynamics of insulin probed by 1h-nmr amide proton exchange anomalous flexibility of the receptor-binding surface
Primary Citation of Related Structures: 2KJJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin | A | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin | B | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTKPT |
Method: SOLUTION NMR
Deposited Date: 2009-05-29 Deposition Author(s): Hua, Q.X. , Weiss, M.A.