A divergent ins protein in c. elegans structurally resemble insulin and activates the human insulin receptor
PDB DOI: 10.2210/pdb2kji/pdb
Classification: HORMONE Organism(s): Caenorhabditis Elegans
Deposited: 2009-05-28 Deposition Author(s): Bass, J. , Hua, Q.X. , Jia, W.H. , Nakarawa, S.H. , Ramos, R.R. , Weiss, M.A. , Wilken, R.
A divergent ins protein in c. elegans structurally resemble insulin and activates the human insulin receptor
Bass, J. , Hua, Q.X. , Jia, W.H. , Nakarawa, S.H. , Ramos, R.R. , Weiss, M.A. , Wilken, R.
Primary Citation of Related Structures: 2KJI
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Probable insulin-like peptide beta-type 5 | A | 50 | Caenorhabditis Elegans | GETRACGRKLISLVMAVCGDLCNPQEGKDIATECCGNQCSDDYIRSACCP |
Method: SOLUTION NMR
Deposited Date: 2009-05-28 Deposition Author(s): Bass, J. , Hua, Q.X. , Jia, W.H. , Nakarawa, S.H. , Ramos, R.R. , Weiss, M.A. , Wilken, R.