2KJ7
Three-dimensional nmr structure of rat islet amyloid polypeptide in dpc micelles
PDB DOI: 10.2210/pdb2kj7/pdb
Classification: HORMONE Organism(s): Rattus Norvegicus
Deposited: 2009-05-22 Deposition Author(s): Brender, J.R. , Hartman, K. , Nanga, R. , Ramamoorthy, A. , Subramanian, V. , Xu, J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Three-dimensional nmr structure of rat islet amyloid polypeptide in dpc micelles
Brender, J.R. , Hartman, K. , Nanga, R. , Ramamoorthy, A. , Subramanian, V. , Xu, J.
Primary Citation of Related Structures: 2KJ7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Islet amyloid polypeptide | A | 38 | Rattus Norvegicus | KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYX |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-05-22 Deposition Author(s): Brender, J.R. , Hartman, K. , Nanga, R. , Ramamoorthy, A. , Subramanian, V. , Xu, J.