Solution structure of the complex of vek-30 and plasminogen kringle 2
PDB DOI: 10.2210/pdb2kj4/pdb
Classification: BLOOD CLOTTING Organism(s): Homo Sapiens , Streptococcus Pyogenes
Deposited: 2009-05-21 Deposition Author(s): Castellin, F.J. , Prorok, M. , Wang, M. , Zajicek, J.
Solution structure of the complex of vek-30 and plasminogen kringle 2
Castellin, F.J. , Prorok, M. , Wang, M. , Zajicek, J.
Primary Citation of Related Structures: 2KJ4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| plasminogen | A | 87 | Homo Sapiens , Streptococcus Pyogenes | YVEFSEECMHGSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRDLRPWCFTTDPNKRWEYCDIPRCAA |
| VEK-30 | B | 32 | Homo Sapiens , Streptococcus Pyogenes | GSVEKLTADAELQRLKNERHEEAELERLKSEY |
Method: SOLUTION NMR
Deposited Date: 2009-05-21 Deposition Author(s): Castellin, F.J. , Prorok, M. , Wang, M. , Zajicek, J.