The solution structure of the reduced yeast tor1 fatc domain bound to dpc micelles at 298k
PDB DOI: 10.2210/pdb2kit/pdb
Classification: TRANSFERASE Organism(s): Grouper Iridovirus
Deposited: 2009-05-11 Deposition Author(s): Dames, S.A.
The solution structure of the reduced yeast tor1 fatc domain bound to dpc micelles at 298k
Primary Citation of Related Structures: 2KIT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Serine/threonine-protein kinase TOR1 | A | 33 | Grouper Iridovirus | NELDVPEQVDKLIQQATSIERLCQHYIGWCPFW |
Method: SOLUTION NMR
Deposited Date: 2009-05-11 Deposition Author(s): Dames, S.A.