Solution structure of the ff domain 2 of human transcription elongation factor ca150
PDB DOI: 10.2210/pdb2kiq/pdb
Classification: TRANSCRIPTION REGULATOR Organism(s): Salmonella Enterica
Deposited: 2009-05-07 Deposition Author(s): Boyles, J. , Donald, B.R. , Tripathy, C. , Yan, A. , Zeng, J. , Zhou, P.
Solution structure of the ff domain 2 of human transcription elongation factor ca150
Boyles, J. , Donald, B.R. , Tripathy, C. , Yan, A. , Zeng, J. , Zhou, P.
Primary Citation of Related Structures: 2KIQ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription elongation regulator 1 | A | 62 | Salmonella Enterica | SHMKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARK |
Method: SOLUTION NMR
Deposited Date: 2009-05-07 Deposition Author(s): Boyles, J. , Donald, B.R. , Tripathy, C. , Yan, A. , Zeng, J. , Zhou, P.