Nmr structure of the oxidized yeast tor1 fatc domain bound to dpc micelles at 318k
PDB DOI: 10.2210/pdb2kio/pdb
Classification: TRANSFERASE Organism(s): Saccharomyces Cerevisiae
Deposited: 2009-05-07 Deposition Author(s): Dames, S.A.
Nmr structure of the oxidized yeast tor1 fatc domain bound to dpc micelles at 318k
Primary Citation of Related Structures: 2KIO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Serine/threonine-protein kinase TOR1 | A | 33 | Saccharomyces Cerevisiae | NELDVPEQVDKLIQQATSIERLCQHYIGWCPFW |
Method: SOLUTION NMR
Deposited Date: 2009-05-07 Deposition Author(s): Dames, S.A.