Solution structure of the ubiquitin-binding motif of human polymerase iota
PDB DOI: 10.2210/pdb2khu/pdb
Classification: Transferase/protein binding Organism(s): Streptococcus Sp., Homo Sapiens
Deposited: 2009-04-11 Deposition Author(s): Bienko, M. , Bomar, M.G. , D'Souza, S. , Dikic, I. , Walker, G.
Solution structure of the ubiquitin-binding motif of human polymerase iota
Bienko, M. , Bomar, M.G. , D'Souza, S. , Dikic, I. , Walker, G.
Primary Citation of Related Structures: 2KHU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunoglobulin G-binding protein G, DNA polymerase iota | A | 108 | Streptococcus Sp., Homo Sapiens | MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSDEKITFPSDIDPQVFYELPEAVQKELLAEWKRTGSDFHIGHKLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2009-04-11 Deposition Author(s): Bienko, M. , Bomar, M.G. , D'Souza, S. , Dikic, I. , Walker, G.