Nmr structure of human alpha defensin hnp-1
PDB DOI: 10.2210/pdb2kht/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Salmonella Enterica
Deposited: 2009-04-11 Deposition Author(s): Barinka, C. , Doherty, T.F. , Hong, M. , Li, J. , Li, S. , Lu, W. , Lubkowski, J. , Zhang, Y.
Nmr structure of human alpha defensin hnp-1
Barinka, C. , Doherty, T.F. , Hong, M. , Li, J. , Li, S. , Lu, W. , Lubkowski, J. , Zhang, Y.
Primary Citation of Related Structures: 2KHT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Neutrophil defensin 1 | A | 30 | Salmonella Enterica | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Method: SOLID-STATE NMR
Deposited Date: 2009-04-11 Deposition Author(s): Barinka, C. , Doherty, T.F. , Hong, M. , Li, J. , Li, S. , Lu, W. , Lubkowski, J. , Zhang, Y.