2KHH
Structural requirements for the uba domain of the mrna export factor mex67 to bind its specific targets, the transcription elongation tho complex component hpr1 and nucleoporin fxfg repeats
PDB DOI: 10.2210/pdb2khh/pdb
Classification: TRANSPORT PROTEIN Organism(s): Saccharomyces Cerevisiae , Synthetic Construct
Deposited: 2009-04-06 Deposition Author(s): Brockmann, C. , Dargemont, C. , Divita, G. , Gruessing, F. , Hobeika, M. , Neuhaus, D. , Stewart, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structural requirements for the uba domain of the mrna export factor mex67 to bind its specific targets, the transcription elongation tho complex component hpr1 and nucleoporin fxfg repeats
Brockmann, C. , Dargemont, C. , Divita, G. , Gruessing, F. , Hobeika, M. , Neuhaus, D. , Stewart, M.
Primary Citation of Related Structures: 2KHH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| mRNA export factor MEX67 | A | 59 | Saccharomyces Cerevisiae , Synthetic Construct | GSRLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF |
| FxFG | B | 9 | Saccharomyces Cerevisiae , Synthetic Construct | DSGFSFGSK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-04-06 Deposition Author(s): Brockmann, C. , Dargemont, C. , Divita, G. , Gruessing, F. , Hobeika, M. , Neuhaus, D. , Stewart, M.