2KGI
Solution structure of jarid1a c-terminal phd finger in complex with h3(1-9)k4me3
PDB DOI: 10.2210/pdb2kgi/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-03-12 Deposition Author(s): Patel, D.J. , Song, J. , Wang, Z.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of jarid1a c-terminal phd finger in complex with h3(1-9)k4me3
Patel, D.J. , Song, J. , Wang, Z.
Primary Citation of Related Structures: 2KGI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone demethylase JARID1A | A | 52 | Homo Sapiens , Synthetic Construct | SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA |
| H3(1-9)K4me3 | B | 9 | Homo Sapiens , Synthetic Construct | ARTKQTARK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-03-12 Deposition Author(s): Patel, D.J. , Song, J. , Wang, Z.