Solution structure of brachyperma ruhnaui toxin 2
PDB DOI: 10.2210/pdb2kgh/pdb
Classification: TOXIN Organism(s): Brachypelma Ruhnaui
Deposited: 2009-03-12 Deposition Author(s): Alagon, A. , Bernard, C. , Bosmans, F. , Clement, H. , Corzo, G. , Darbon, H. , Possani, L.D. , Tygat, J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of brachyperma ruhnaui toxin 2
Alagon, A. , Bernard, C. , Bosmans, F. , Clement, H. , Corzo, G. , Darbon, H. , Possani, L.D. , Tygat, J.
Primary Citation of Related Structures: 2KGH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Venom peptide 2 | A | 39 | Brachypelma Ruhnaui | IFECVFSCDIKKEGKPCKPKGEKKCTGGWRCKIKLCLKI |
Method: SOLUTION NMR
Deposited Date: 2009-03-12 Deposition Author(s): Alagon, A. , Bernard, C. , Bosmans, F. , Clement, H. , Corzo, G. , Darbon, H. , Possani, L.D. , Tygat, J.