Nmr solution of the regulatory domain cardiac f77w-troponin c in complex with the cardiac troponin i 144-163 switch peptide
PDB DOI: 10.2210/pdb2kgb/pdb
Classification: CONTRACTILE PROTEIN/CA BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-03-07 Deposition Author(s): Crane, M.L. , Julien, O. , Mercier, P. , Sykes, B.D.
Nmr solution of the regulatory domain cardiac f77w-troponin c in complex with the cardiac troponin i 144-163 switch peptide
Crane, M.L. , Julien, O. , Mercier, P. , Sykes, B.D.
Primary Citation of Related Structures: 2KGB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Troponin C, slow skeletal and cardiac muscles | C | 89 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEWLVMMVRCMKDDS |
Troponin I, cardiac muscle | I | 20 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RRVRISADAMMQALLGARAK |
Method: SOLUTION NMR
Deposited Date: 2009-03-07 Deposition Author(s): Crane, M.L. , Julien, O. , Mercier, P. , Sykes, B.D.