2KG1
Structure of the third qrrm domain of hnrnp f in complex with a agggau g-tract rna
PDB DOI: 10.2210/pdb2kg1/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-03-02 Deposition Author(s): Allain, F.H.T. , Dominguez, C.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of the third qrrm domain of hnrnp f in complex with a agggau g-tract rna
Allain, F.H.T. , Dominguez, C.
Primary Citation of Related Structures: 2KG1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Heterogeneous nuclear ribonucleoprotein F | A | 139 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSGDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMG |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'-R(*AP*GP*GP*GP*AP*U)-3' | b | 6 | NA | AGGGAU |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-03-02 Deposition Author(s): Allain, F.H.T. , Dominguez, C.