Structure of the c-terminal domain of ehd1 with fnyestnpftak
PDB DOI: 10.2210/pdb2kff/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-02-20 Deposition Author(s): Caplan, S. , Jovic, M. , Kieken, F. , Naslavsky, N. , Sorgen, P. , Tonelli, M.
Structure of the c-terminal domain of ehd1 with fnyestnpftak
Caplan, S. , Jovic, M. , Kieken, F. , Naslavsky, N. , Sorgen, P. , Tonelli, M.
Primary Citation of Related Structures: 2KFF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
EH domain-containing protein 1 | A | 105 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE |
Rab11-FIP2 NPF peptide FNYESTNPFTAK | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | FNYESTNPFTAK |
Method: SOLUTION NMR
Deposited Date: 2009-02-20 Deposition Author(s): Caplan, S. , Jovic, M. , Kieken, F. , Naslavsky, N. , Sorgen, P. , Tonelli, M.