2KEL
Structure of the transcription regulator svtr from the hyperthermophilic archaeal virus sirv1
PDB DOI: 10.2210/pdb2kel/pdb
Classification: TRANSCRIPTION REPRESSOR Organism(s): Sulfolobus Islandicus Rod-Shaped Virus 1
Deposited: 2009-01-30 Deposition Author(s): Delepierre, M. , Guijarro, J.I. , Guilliere, F. , Kessler, A. , Peixeiro, N. , Prangishvili, D. , Sezonov, G.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of the transcription regulator svtr from the hyperthermophilic archaeal virus sirv1
Delepierre, M. , Guijarro, J.I. , Guilliere, F. , Kessler, A. , Peixeiro, N. , Prangishvili, D. , Sezonov, G.
Primary Citation of Related Structures: 2KEL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein 56B | A | 56 | Sulfolobus Islandicus Rod-Shaped Virus 1 | MQTQEQSQKKKQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG |
| Uncharacterized protein 56B | B | 56 | Sulfolobus Islandicus Rod-Shaped Virus 1 | MQTQEQSQKKKQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-01-30 Deposition Author(s): Delepierre, M. , Guijarro, J.I. , Guilliere, F. , Kessler, A. , Peixeiro, N. , Prangishvili, D. , Sezonov, G.