2KDB
Solution structure of human ubiquitin-like domain of herpud2_9_85, northeast structural genomics consortium (nesg) target ht53a
PDB DOI: 10.2210/pdb2kdb/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2009-01-06 Deposition Author(s): Arrowsmith, C. , Dhe-Paganon, S. , Doherty, R. , Fares, C. , Gutmanas, A. , Lemak, A. , Northeast Structural Genomics Consortium (Nesg) , Semesi, A. , Structural Genomics Consortium (Sgc) , Wu, B. , Yee, A.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of human ubiquitin-like domain of herpud2_9_85, northeast structural genomics consortium (nesg) target ht53a
Arrowsmith, C. , Dhe-Paganon, S. , Doherty, R. , Fares, C. , Gutmanas, A. , Lemak, A. , Northeast Structural Genomics Consortium (Nesg) , Semesi, A. , Structural Genomics Consortium (Sgc) , Wu, B. , Yee, A.
Primary Citation of Related Structures: 2KDB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein | A | 99 | Homo Sapiens | MGSSHHHHHHSSGRENLYFQGHPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLV |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-01-06 Deposition Author(s): Arrowsmith, C. , Dhe-Paganon, S. , Doherty, R. , Fares, C. , Gutmanas, A. , Lemak, A. , Northeast Structural Genomics Consortium (Nesg) , Semesi, A. , Structural Genomics Consortium (Sgc) , Wu, B. , Yee, A.