Nmr solution structure of o64736 protein from arabidopsis thaliana. northeast structural genomics consortium mega target ar3445a
PDB DOI: 10.2210/pdb2kd0/pdb
Classification: SIGNALING PROTEIN Organism(s): Arabidopsis Thaliana
Deposited: 2008-12-31 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Everett, J. , Foote, E. , Huang, Y. , Jiang, M. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Shastry, R. , Swapna, G.V.T. , Xiao, R.
Nmr solution structure of o64736 protein from arabidopsis thaliana. northeast structural genomics consortium mega target ar3445a
Acton, T.B. , Ciccosanti, C. , Everett, J. , Foote, E. , Huang, Y. , Jiang, M. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Shastry, R. , Swapna, G.V.T. , Xiao, R.
Primary Citation of Related Structures: 2KD0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
LRR repeats and ubiquitin-like domain-containing protein At2g30105 | A | 85 | Arabidopsis Thaliana | MGHHHHHHSHSTIKLTVKFGGKSIPLSVSPDCTVKDLKSQLQPITNVLPRGQKLIFKGKVLVETSTLKQSDVGSGAKLMLMASQG |
Method: SOLUTION NMR
Deposited Date: 2008-12-31 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Everett, J. , Foote, E. , Huang, Y. , Jiang, M. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Shastry, R. , Swapna, G.V.T. , Xiao, R.