The nmr solution structure of the isolated apo pin1 ww domain
PDB DOI: 10.2210/pdb2kcf/pdb
Classification: ISOMERASE Organism(s): Salmonella Enterica
Deposited: 2008-12-19 Deposition Author(s): Kelly, J.W. , Kowalski, J.A. , Liu, K.
Method: SOLUTION NMR Resolution: N.A.
The nmr solution structure of the isolated apo pin1 ww domain
Kelly, J.W. , Kowalski, J.A. , Liu, K.
Primary Citation of Related Structures: 2KCF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | A | 36 | Salmonella Enterica | GSKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSG |
Method: SOLUTION NMR
Deposited Date: 2008-12-19 Deposition Author(s): Kelly, J.W. , Kowalski, J.A. , Liu, K.