Solution nmr structure of ssp0047 from staphylococcus saprophyticus. northeast structural genomics consortium target syr6.
PDB DOI: 10.2210/pdb2kcd/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Staphylococcus Saprophyticus Subsp. Saprophyticus Atcc 15305
Deposited: 2008-12-19 Deposition Author(s): Acton, T.B. , Baran, M.C. , Chen, C.X. , Ciccosanti, C. , Ding, K. , Jiang, M. , Kennedy, M.A. , Liu, J. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Rost, B. , Swapna, G. , Xiao, R.
Solution nmr structure of ssp0047 from staphylococcus saprophyticus. northeast structural genomics consortium target syr6.
Acton, T.B. , Baran, M.C. , Chen, C.X. , Ciccosanti, C. , Ding, K. , Jiang, M. , Kennedy, M.A. , Liu, J. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Rost, B. , Swapna, G. , Xiao, R.
Primary Citation of Related Structures: 2KCD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein SSP0047 | A | 120 | Staphylococcus Saprophyticus Subsp. Saprophyticus Atcc 15305 | MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMPLLDQRYLLTGGQLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2008-12-19 Deposition Author(s): Acton, T.B. , Baran, M.C. , Chen, C.X. , Ciccosanti, C. , Ding, K. , Jiang, M. , Kennedy, M.A. , Liu, J. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Rost, B. , Swapna, G. , Xiao, R.