Nmr solution structure of the pheromone en-1 of euplotes nobilii at -1.5 c
PDB DOI: 10.2210/pdb2kc6/pdb
Classification: SIGNALING PROTEIN Organism(s): Euplotes Nobilii
Deposited: 2008-12-17 Deposition Author(s): Alimenti, C. , Luporini, P. , Pedrini, B. , Vallesi, A. , Wuthrich, K.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of the pheromone en-1 of euplotes nobilii at -1.5 c
Alimenti, C. , Luporini, P. , Pedrini, B. , Vallesi, A. , Wuthrich, K.
Primary Citation of Related Structures: 2KC6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mating pheromone En-1 | A | 52 | Euplotes Nobilii | NPEDWFTPDTCAYGDSNTAWTTCTTPGQTCYTCCSSCFDVVGEQACQMSAQC |
Method: SOLUTION NMR
Deposited Date: 2008-12-17 Deposition Author(s): Alimenti, C. , Luporini, P. , Pedrini, B. , Vallesi, A. , Wuthrich, K.