Solution nmr structure of bnip3 transmembrane peptide dimer in detergent micelles
PDB DOI: 10.2210/pdb2ka1/pdb
Classification: MEMBRANE PROTEIN Organism(s): Salmonella Enterica
Deposited: 2008-10-30 Deposition Author(s): Mackenzie, K.R. , Sulistijo, E.S.
Solution nmr structure of bnip3 transmembrane peptide dimer in detergent micelles
Mackenzie, K.R. , Sulistijo, E.S.
Primary Citation of Related Structures: 2KA1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 | A | 35 | Salmonella Enterica | GGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLT |
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 | B | 35 | Salmonella Enterica | GGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLT |
Method: SOLUTION NMR
Deposited Date: 2008-10-30 Deposition Author(s): Mackenzie, K.R. , Sulistijo, E.S.