Solution nmr structure of the filamin-migfilin complex
PDB DOI: 10.2210/pdb2k9u/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2008-10-24 Deposition Author(s): Ithychanda, S.N. , Qin, J.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of the filamin-migfilin complex
Primary Citation of Related Structures: 2K9U
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Gamma filamin | A | 119 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GIPEFFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTS |
Filamin-binding LIM protein 1 | B | 24 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MASKPEKRVASSVFITLAPPRRDV |
Method: SOLUTION NMR
Deposited Date: 2008-10-24 Deposition Author(s): Ithychanda, S.N. , Qin, J.