Nmr solution structure for shk-192: a potent kv1.3-specific immunosuppressive polypeptide
PDB DOI: 10.2210/pdb2k9e/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2008-10-09 Deposition Author(s): Galea, C.A.
Nmr solution structure for shk-192: a potent kv1.3-specific immunosuppressive polypeptide
Primary Citation of Related Structures: 2K9E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Kappa-stichotoxin-She3a | A | 38 | N.A. | FXRSCIDTIPKSRCTAFQCKHSLKYRLSFCRKTCGTCX |
Method: SOLUTION NMR
Deposited Date: 2008-10-09 Deposition Author(s): Galea, C.A.