Association of subunit d (vma6p) and e (vma4p) with g (vma10p) and the nmr solution structure of subunit g (g1-59) of the saccharomyces cerevisiae v1vo atpase
PDB DOI: 10.2210/pdb2k88/pdb
Classification: HYDROLASE Organism(s): Saccharomyces Cerevisiae
Deposited: 2008-09-04 Deposition Author(s): Gayen, S. , Gruber, G. , Manimekalai, M.S.S. , Sankaranarayanan, N. , Subramanian, V. , Thaker, Y.
Method: SOLUTION NMR Resolution: N.A.
Association of subunit d (vma6p) and e (vma4p) with g (vma10p) and the nmr solution structure of subunit g (g1-59) of the saccharomyces cerevisiae v1vo atpase
Gayen, S. , Gruber, G. , Manimekalai, M.S.S. , Sankaranarayanan, N. , Subramanian, V. , Thaker, Y.
Primary Citation of Related Structures: 2K88
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Vacuolar proton pump subunit G | A | 60 | Saccharomyces Cerevisiae | MVSQKNGIATLLQAEKEAHEIVSKARKYRQDKLKQAKTDAAKEIDSYKIQKDKELKEFEC |
Method: SOLUTION NMR
Deposited Date: 2008-09-04 Deposition Author(s): Gayen, S. , Gruber, G. , Manimekalai, M.S.S. , Sankaranarayanan, N. , Subramanian, V. , Thaker, Y.