Nmr structure of a complex formed by the c-terminal domain of human rap74 and a phosphorylated peptide from the central domain of the fcp1
PDB DOI: 10.2210/pdb2k7l/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2008-08-13 Deposition Author(s): Abbott, K.L. , Desjardins, A. , Di Lello, P. , Legault, P. , Omichinski, J.G. , Yang, A.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of a complex formed by the c-terminal domain of human rap74 and a phosphorylated peptide from the central domain of the fcp1
Abbott, K.L. , Desjardins, A. , Di Lello, P. , Legault, P. , Omichinski, J.G. , Yang, A.
Primary Citation of Related Structures: 2K7L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| centFCP1-T584PO4 peptide | B | 19 | Homo Sapiens , Synthetic Construct | EDTDEDDHLIYLEEILVRV |
| General transcription factor IIF subunit 1 | A | 67 | Homo Sapiens , Synthetic Construct | DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE |
Method: SOLUTION NMR
Deposited Date: 2008-08-13 Deposition Author(s): Abbott, K.L. , Desjardins, A. , Di Lello, P. , Legault, P. , Omichinski, J.G. , Yang, A.