Solution structure of the binary complex between the sh3 and sh2 domain of interleukin-2 tyrosine kinase
PDB DOI: 10.2210/pdb2k79/pdb
Classification: TRANSFERASE Organism(s): Mus Musculus
Deposited: 2008-08-08 Deposition Author(s): Andreotti, A.H. , Fulton, D.B. , Severin, A.J.
Solution structure of the binary complex between the sh3 and sh2 domain of interleukin-2 tyrosine kinase
Andreotti, A.H. , Fulton, D.B. , Severin, A.J.
Primary Citation of Related Structures: 2K79
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SH3 domain of Tyrosine-protein kinase ITK/TSK | A | 63 | Mus Musculus | GSPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKSP |
| SH2 domain of Tyrosine-protein kinase ITK/TSK | B | 110 | Mus Musculus | GSNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCG |
Method: SOLUTION NMR
Deposited Date: 2008-08-08 Deposition Author(s): Andreotti, A.H. , Fulton, D.B. , Severin, A.J.