Structure of rab11-fip2 c-terminal coiled-coil domain
PDB DOI: 10.2210/pdb2k6s/pdb
Classification: PROTEIN TRANSPORT Organism(s): Salmonella Enterica
Deposited: 2008-07-18 Deposition Author(s): Baleja, J.D. , Liu, Y. , Wei, J.
Structure of rab11-fip2 c-terminal coiled-coil domain
Baleja, J.D. , Liu, Y. , Wei, J.
Primary Citation of Related Structures: 2K6S
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Rab11fip2 protein | A | 41 | Salmonella Enterica | GSLTYEEVLQELVKHKELLRRKDTHIRELEDYIDNLLVRVM |
Rab11fip2 protein | B | 41 | Salmonella Enterica | GSLTYEEVLQELVKHKELLRRKDTHIRELEDYIDNLLVRVM |
Method: SOLUTION NMR
Deposited Date: 2008-07-18 Deposition Author(s): Baleja, J.D. , Liu, Y. , Wei, J.