2K6L
The solution structure of xacb0070 from xanthonomas axonopodis pv citri reveals this new protein is a member of the rhh family of transcriptional repressors
PDB DOI: 10.2210/pdb2k6l/pdb
Classification: UNKNOWN FUNCTION Organism(s): Xanthomonas Axonopodis Pv. Citri
Deposited: 2008-07-11 Deposition Author(s): Amata, I. , Cicero, D.O. , Eliseo, T. , Farah, C.S. , Ferrari, E. , Gallo, M. , Paci, M. , Pertinhez, T.A. , Spisni, A.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
The solution structure of xacb0070 from xanthonomas axonopodis pv citri reveals this new protein is a member of the rhh family of transcriptional repressors
Amata, I. , Cicero, D.O. , Eliseo, T. , Farah, C.S. , Ferrari, E. , Gallo, M. , Paci, M. , Pertinhez, T.A. , Spisni, A.
Primary Citation of Related Structures: 2K6L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative uncharacterized protein | A | 51 | Xanthomonas Axonopodis Pv. Citri | MNTVRWNIAVSPDVDQSVRMFIAAQGGGRKGDLSRFIEDAVRAYLFERAVE |
| Putative uncharacterized protein | B | 51 | Xanthomonas Axonopodis Pv. Citri | MNTVRWNIAVSPDVDQSVRMFIAAQGGGRKGDLSRFIEDAVRAYLFERAVE |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2008-07-11 Deposition Author(s): Amata, I. , Cicero, D.O. , Eliseo, T. , Farah, C.S. , Ferrari, E. , Gallo, M. , Paci, M. , Pertinhez, T.A. , Spisni, A.