The domain features of the peripheral stalk subunit h of the methanogenic a1ao atp synthase and the nmr solution structure of h1-47
PDB DOI: 10.2210/pdb2k6i/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Methanocaldococcus Jannaschii
Deposited: 2008-07-09 Deposition Author(s): Biukovic, G. , Biukovic, N. , Gayen, S. , Gruber, G. , Pervushin, K.
The domain features of the peripheral stalk subunit h of the methanogenic a1ao atp synthase and the nmr solution structure of h1-47
Biukovic, G. , Biukovic, N. , Gayen, S. , Gruber, G. , Pervushin, K.
Primary Citation of Related Structures: 2K6I
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Uncharacterized protein MJ0223 | A | 56 | Methanocaldococcus Jannaschii | MKHHHHHHPMGVSVMEAIKEVKLAEEQAVKEIEEAKNRAEQIKAEAIEEAKKLIAC |
Method: SOLUTION NMR
Deposited Date: 2008-07-09 Deposition Author(s): Biukovic, G. , Biukovic, N. , Gayen, S. , Gruber, G. , Pervushin, K.